Lineage for d1at1d1 (1at1 D:8-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504162Domain d1at1d1: 1at1 D:8-100 [39050]
    Other proteins in same PDB: d1at1a1, d1at1a2, d1at1b2, d1at1c1, d1at1c2, d1at1d2

Details for d1at1d1

PDB Entry: 1at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral p*h

SCOP Domain Sequences for d1at1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1at1d1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1at1d1:

Click to download the PDB-style file with coordinates for d1at1d1.
(The format of our PDB-style files is described here.)

Timeline for d1at1d1: