Lineage for d4k79c_ (4k79 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460208Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2460209Protein automated matches [190787] (14 species)
    not a true protein
  7. 2460291Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)
  8. 2460314Domain d4k79c_: 4k79 C: [390481]
    automated match to d3e6ja_

Details for d4k79c_

PDB Entry: 4k79 (more details), 2.2 Å

PDB Description: recognition of the thomsen-friedenreich antigen by a lamprey variable lymphocyte receptor
PDB Compounds: (C:) Variable lymphocyte receptor

SCOPe Domain Sequences for d4k79c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k79c_ c.10.2.0 (C:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgtevncagkslasvpagiptttrvlylnsnqitklepgvfdrlanlrelhl
wgnqlvslppgvfdnlanleklwlnsnqltslpaglfdrlvnlehlglccmkltelpsga
fdkltrlkqlgldqnqlksipdgafarlpslthvwlhtnpwdcqctdilylsgwvaqhss
ivgegwpwrhspdsakcsgtntpvravteastspskcp

SCOPe Domain Coordinates for d4k79c_:

Click to download the PDB-style file with coordinates for d4k79c_.
(The format of our PDB-style files is described here.)

Timeline for d4k79c_: