Lineage for d7k35d1 (7k35 D:1-163,D:340-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785523Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
    Uniprot P00327
  8. 2785535Domain d7k35d1: 7k35 D:1-163,D:340-374 [390447]
    Other proteins in same PDB: d7k35a2, d7k35b2, d7k35c2, d7k35d2
    automated match to d1heta1
    complexed with mrd, nai, vtg, zn

Details for d7k35d1

PDB Entry: 7k35 (more details), 1.2 Å

PDB Description: eqadh-nadh-4-methylbenzyl alcohol, p21
PDB Compounds: (D:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d7k35d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k35d1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d7k35d1:

Click to download the PDB-style file with coordinates for d7k35d1.
(The format of our PDB-style files is described here.)

Timeline for d7k35d1: