Lineage for d7k47a1 (7k47 A:1-250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899440Species Stenotrophomonas maltophilia [TaxId:522373] [390377] (1 PDB entry)
  8. 2899441Domain d7k47a1: 7k47 A:1-250 [390378]
    Other proteins in same PDB: d7k47a2, d7k47a3
    automated match to d2v0ha1

Details for d7k47a1

PDB Entry: 7k47 (more details), 2.9 Å

PDB Description: crystal structure of glucosamine-1-phosphate n-acetyltransferase from stenotrophomonas maltophilia k279a
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d7k47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k47a1 c.68.1.0 (A:1-250) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
mtqplhviilaagagkrmksvlpkvlqpiagqpmlahvidaarelqpaaihvvhghggea
vrqyfagqpdlqwaeqaqqlgtghavaqampqvpdlaqvlvlygdvpliraqtlrdllaq
pgrlavlvadvddptgygrvlrdaegkvgaiieqkdatddqlrvrtintgiiaaestalr
rwlsqlsnsnaqgeyyltdvfafaaheytpaemalvadaqeaegandpwqlsqlerawqr
ravralcaqg

SCOPe Domain Coordinates for d7k47a1:

Click to download the PDB-style file with coordinates for d7k47a1.
(The format of our PDB-style files is described here.)

Timeline for d7k47a1: