SCOP 1.71: Domain d1rahb1: 1rah B:1-100

Lineage for d1rahb1 (1rah B:1-100)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
Protein Aspartate carbamoyltransferase [54895] (2 species)
Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
Domain d1rahb1: 1rah B:1-100 [39037]
Other proteins in same PDB: d1raha1, d1raha2, d1rahb2, d1rahc1, d1rahc2, d1rahd2

Details for d1rahb1

PDB Entry: 1rah (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rahb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rahb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1rahb1:

Click to download the PDB-style file with coordinates for d1rahb1.
(The format of our PDB-style files is described here.)

Timeline for d1rahb1: