Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
Domain d1rahb1: 1rah B:1-100 [39037] Other proteins in same PDB: d1raha1, d1raha2, d1rahb2, d1rahc1, d1rahc2, d1rahd2 complexed with ctp, zn; mutant |
PDB Entry: 1rah (more details), 2.5 Å
SCOPe Domain Sequences for d1rahb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rahb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik ientflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1rahb1: