Lineage for d7jvna2 (7jvn A:111-218)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 3090294Domain d7jvna2: 7jvn A:111-218 [390356]
    Other proteins in same PDB: d7jvna3, d7jvnb3
    automated match to d2shpa3
    complexed with po4, vkp

Details for d7jvna2

PDB Entry: 7jvn (more details), 1.92 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor compound 24
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d7jvna2:

Sequence, based on SEQRES records: (download)

>d7jvna2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d7jvna2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvrepgdfvlsvrtgdskvthvmircqelkydvgg
gerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d7jvna2:

Click to download the PDB-style file with coordinates for d7jvna2.
(The format of our PDB-style files is described here.)

Timeline for d7jvna2:

  • d7jvna2 is new in SCOPe 2.07-stable