Lineage for d1raad1 (1raa D:1-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504144Domain d1raad1: 1raa D:1-100 [39034]
    Other proteins in same PDB: d1raaa1, d1raaa2, d1raab2, d1raac1, d1raac2, d1raad2

Details for d1raad1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raad1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1raad1:

Click to download the PDB-style file with coordinates for d1raad1.
(The format of our PDB-style files is described here.)

Timeline for d1raad1: