SCOP 1.55: Domain d1raad1: 1raa D:1-100

Lineage for d1raad1 (1raa D:1-100)

Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
Protein Aspartate carbamoyltransferase [54895] (1 species)
Species Escherichia coli [TaxId:562] [54896] (25 PDB entries)
Domain d1raad1: 1raa D:1-100 [39034]
Other proteins in same PDB: d1raaa1, d1raaa2, d1raab2, d1raac1, d1raac2, d1raad2

Details for d1raad1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raad1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1raad1:

Click to download the PDB-style file with coordinates for d1raad1.
(The format of our PDB-style files is described here.)

Timeline for d1raad1: