Lineage for d1rafd1 (1raf D:1-100)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1414016Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1414017Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1414018Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1414019Species Escherichia coli [TaxId:562] [54896] (59 PDB entries)
    Uniprot P00478
  8. 1414069Domain d1rafd1: 1raf D:1-100 [39032]
    Other proteins in same PDB: d1rafa1, d1rafa2, d1rafb2, d1rafc1, d1rafc2, d1rafd2
    complexed with ctp, zn; mutant

Details for d1rafd1

PDB Entry: 1raf (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1rafd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rafd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1rafd1:

Click to download the PDB-style file with coordinates for d1rafd1.
(The format of our PDB-style files is described here.)

Timeline for d1rafd1: