Lineage for d3js8a1 (3js8 A:3-217)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593943Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2593944Protein automated matches [191143] (12 species)
    not a true protein
  7. 2593947Species Chromobacterium sp. [TaxId:507619] [390317] (1 PDB entry)
  8. 2593948Domain d3js8a1: 3js8 A:3-217 [390318]
    Other proteins in same PDB: d3js8a2
    automated match to d1i19a2
    complexed with fad

Details for d3js8a1

PDB Entry: 3js8 (more details)

PDB Description: solvent-stable cholesterol oxidase
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3js8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js8a1 d.145.1.0 (A:3-217) automated matches {Chromobacterium sp. [TaxId: 507619]}
sqpnnfpaeiplykqsfknwagdikvddvwtcaprsadevvkvanwakdngykvrargmm
hnwspltlaagvscpavvlldttryltamsidasgpvakvtaqagitmealltglekagl
gvtaapapgdltlggvlainghgtaipakgerrlagasygsisnlvlsltavvydkasga
yalrkfarndpqiapllahvgrsliveatlqaapn

SCOPe Domain Coordinates for d3js8a1:

Click to download the PDB-style file with coordinates for d3js8a1.
(The format of our PDB-style files is described here.)

Timeline for d3js8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3js8a2