Lineage for d3js8a1 (3js8 A:3-217)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) 
Family d.145.1.0: automated matches [191624] (1 protein)
not a true familyProtein automated matches [191143] (13 species)
not a true protein
Species Chromobacterium sp. [TaxId:507619] [390317] (1 PDB entry) 
Domain d3js8a1: 3js8 A:3-217 [390318]
Other proteins in same PDB: d3js8a2
automated match to d1i19a2
complexed with fad
Details for d3js8a1
PDB Entry: 3js8 (more details), 1.54 Å
PDB Description: solvent-stable cholesterol oxidase
PDB Compounds: (A:) cholesterol oxidaseSCOPe Domain Sequences for d3js8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js8a1 d.145.1.0 (A:3-217) automated matches {Chromobacterium sp. [TaxId: 507619]}
sqpnnfpaeiplykqsfknwagdikvddvwtcaprsadevvkvanwakdngykvrargmm
hnwspltlaagvscpavvlldttryltamsidasgpvakvtaqagitmealltglekagl
gvtaapapgdltlggvlainghgtaipakgerrlagasygsisnlvlsltavvydkasga
yalrkfarndpqiapllahvgrsliveatlqaapn
SCOPe Domain Coordinates for d3js8a1:
Click to download the PDB-style file with coordinates for d3js8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3js8a1:
- d3js8a1 first appeared in SCOPe 2.07
View in 3D
