![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [51738] (53 PDB entries) Uniprot P00327 |
![]() | Domain d7jqaa2: 7jqa A:164-339 [390303] Other proteins in same PDB: d7jqaa1, d7jqab1, d7jqac1, d7jqad1 automated match to d1heta2 complexed with brb, mpd, nai, zn |
PDB Entry: 7jqa (more details), 1.53 Å
SCOPe Domain Sequences for d7jqaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jqaa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d7jqaa2: