![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
![]() | Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries) Uniprot P00327 |
![]() | Domain d7jqaa1: 7jqa A:1-163,A:340-374 [390302] Other proteins in same PDB: d7jqaa2, d7jqab2, d7jqac2, d7jqad2 automated match to d1heta1 complexed with brb, mpd, nai, zn |
PDB Entry: 7jqa (more details), 1.53 Å
SCOPe Domain Sequences for d7jqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jqaa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki negfdllrsgesirtiltf
Timeline for d7jqaa1: