Lineage for d1raid1 (1rai D:8-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504128Domain d1raid1: 1rai D:8-100 [39030]
    Other proteins in same PDB: d1raia1, d1raia2, d1raib2, d1raic1, d1raic2, d1raid2

Details for d1raid1

PDB Entry: 1rai (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raid1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli}
qveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1raid1:

Click to download the PDB-style file with coordinates for d1raid1.
(The format of our PDB-style files is described here.)

Timeline for d1raid1: