SCOPe 2.07: Domain d7jira1: 7jir A:2-61

Lineage for d7jira1 (7jir A:2-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries)

8. Domain d7jira1: 7jir A:2-61 [390284]
   Other proteins in same PDB: d7jira2
   automated match to d4m0wa1
   complexed with act, cl, mes, ttt, zn; mutant

Details for d7jira1

PDB Entry: 7jir, 2.09 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2 , c111s mutant, in complex with plp_snyder457 inhibitor

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d7jira1:

Sequence; same for both SEQRES and ATOM records:

>d7jira1 d.15.1.0 (A:2-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
vrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

Timeline for d7jira1:

• d7jira1 is new in SCOPe 2.07-stable
  
• d7jira1 appears in the current release, SCOPe 2.08