Lineage for d8atcd1 (8atc D:8-100)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412028Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 412029Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 412030Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 412031Species Escherichia coli [TaxId:562] [54896] (27 PDB entries)
  8. 412043Domain d8atcd1: 8atc D:8-100 [39028]
    Other proteins in same PDB: d8atcb2, d8atcd2
    complexed with pal, zn

Details for d8atcd1

PDB Entry: 8atc (more details), 2.5 Å

PDB Description: complex of n-phosphonacetyl-l-aspartate with aspartate carbamoyltransferase. x-ray refinement, analysis of conformational changes and catalytic and allosteric mechanisms

SCOP Domain Sequences for d8atcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8atcd1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d8atcd1:

Click to download the PDB-style file with coordinates for d8atcd1.
(The format of our PDB-style files is described here.)

Timeline for d8atcd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d8atcd2