Lineage for d6jgqa2 (6jgq A:389-602)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465847Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2465887Family c.23.11.0: automated matches [270742] (1 protein)
    not a true family
  6. 2465888Protein automated matches [270743] (1 species)
    not a true protein
  7. 2465889Species Hordeum vulgare [TaxId:112509] [270744] (33 PDB entries)
  8. 2465912Domain d6jgqa2: 6jgq A:389-602 [390223]
    Other proteins in same PDB: d6jgqa1, d6jgqa3
    automated match to d1x38a2
    complexed with bgc, gol, nag, so4, u2a; mutant

Details for d6jgqa2

PDB Entry: 6jgq (more details), 2.01 Å

PDB Description: crystal structure of barley exohydrolasei w434y mutant in complex with methyl 2-thio-beta-sophoroside.
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOPe Domain Sequences for d6jgqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jgqa2 c.23.11.0 (A:389-602) automated matches {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtieyqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOPe Domain Coordinates for d6jgqa2:

Click to download the PDB-style file with coordinates for d6jgqa2.
(The format of our PDB-style files is described here.)

Timeline for d6jgqa2: