SCOPe 2.08: Domain d6jlle_: 6jll e:

Lineage for d6jlle_ (6jll e:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)

8. Domain d6jlle_: 6jll e: [390220]
   Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_
   automated match to d2axte1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl
   has additional insertions and/or extensions that are not grouped together

Details for d6jlle_

PDB Entry: 6jll, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset1)

PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d6jlle_:

Sequence; same for both SEQRES and ATOM records:

>d6jlle_ f.23.38.1 (e:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

Timeline for d6jlle_:

• d6jlle_ first appeared in SCOPe 2.07