| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
| Protein automated matches [191268] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189843] (8 PDB entries) |
| Domain d7jjka_: 7jjk A: [390208] automated match to d2lefa_ |
PDB Entry: 7jjk (more details), 1.4 Å
SCOPe Domain Sequences for d7jjka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jjka_ a.21.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghvkrpmnafmvwarihrpalakanpaannaeisvqlglewnklseeqkkpyydeaqkik
ekhreefpgwv
Timeline for d7jjka_: