Lineage for d4at1d1 (4at1 D:8-100)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32472Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 32473Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 32474Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 32475Species Escherichia coli [TaxId:562] [54896] (25 PDB entries)
  8. 32481Domain d4at1d1: 4at1 D:8-100 [39020]
    Other proteins in same PDB: d4at1a1, d4at1a2, d4at1b2, d4at1c1, d4at1c2, d4at1d2

Details for d4at1d1

PDB Entry: 4at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d4at1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at1d1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d4at1d1:

Click to download the PDB-style file with coordinates for d4at1d1.
(The format of our PDB-style files is described here.)

Timeline for d4at1d1: