SCOPe 2.07: Domain d7jh3d_: 7jh3 D:

Lineage for d7jh3d_ (7jh3 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [257757] (5 PDB entries)

8. Domain d7jh3d_: 7jh3 D: [390198]
   automated match to d1sffa_
   complexed with peg

Details for d7jh3d_

PDB Entry: 7jh3, 2.68 Å

PDB Description: crystal structure of 4-aminobutyrate aminotransferase puue from escherichia coli in complex with plp

PDB Compounds: (D:) 4-aminobutyrate aminotransferase PuuE

SCOPe Domain Sequences for d7jh3d_:

Sequence; same for both SEQRES and ATOM records:

>d7jh3d_ c.67.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
snnefhqrrlsatprgvgvmcnffaqsaenatlkdvegneyidfaagiavlntghrhpdl
vaaveqqlqqfthtayqivpyesyvtlaekinalapvsgqaktaffttgaeavenavkia
rahtgrpgviafsggfhgrtymtmaltgkvapykigfgpfpgsvyhvpypsdlhgistqd
sldaierlfksdieakqvaaiifepvqgeggfnvapkelvaairrlcdehgivmiadevq
sgfartgklfamdhyadkpdlmtmakslaggmplsgvvgnanimdapapgglggtyagnp
lavaaahavlniidkeslceranqlgqrlkntlidakesvpaiaavrglgsmiavefndp
qtgepsaaiaqkiqqralaqglllltcgaygnvirflypltipdaqfdaamkilqdalsd

Timeline for d7jh3d_:

• d7jh3d_ is new in SCOPe 2.07-stable
  
• d7jh3d_ appears in the current release, SCOPe 2.08