Lineage for d4at1b1 (4at1 B:8-100)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906648Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1906649Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1906650Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1906651Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1906688Domain d4at1b1: 4at1 B:8-100 [39019]
    Other proteins in same PDB: d4at1a1, d4at1a2, d4at1b2, d4at1c1, d4at1c2, d4at1d2
    complexed with atp, zn

Details for d4at1b1

PDB Entry: 4at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d4at1b1:

Click to download the PDB-style file with coordinates for d4at1b1.
(The format of our PDB-style files is described here.)

Timeline for d4at1b1: