Lineage for d4at1b1 (4at1 B:8-100)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257203Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 257204Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 257205Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 257206Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 257211Domain d4at1b1: 4at1 B:8-100 [39019]
    Other proteins in same PDB: d4at1a1, d4at1a2, d4at1b2, d4at1c1, d4at1c2, d4at1d2

Details for d4at1b1

PDB Entry: 4at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d4at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d4at1b1:

Click to download the PDB-style file with coordinates for d4at1b1.
(The format of our PDB-style files is described here.)

Timeline for d4at1b1: