Lineage for d1f1bd1 (1f1b D:1-100)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) 
automatically mapped to Pfam PF01948Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) Protein Aspartate carbamoyltransferase [54895] (3 species) Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
Uniprot P00478
Domain d1f1bd1: 1f1b D:1-100 [39018]
Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb2, d1f1bc1, d1f1bc2, d1f1bd2
complexed with pal, zn; mutant
Details for d1f1bd1
PDB Entry: 1f1b (more details), 2.3 Å
PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chainSCOPe Domain Sequences for d1f1bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1bd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp
SCOPe Domain Coordinates for d1f1bd1:
Click to download the PDB-style file with coordinates for d1f1bd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f1bd1:
View in 3D
