![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.7: NagZ-like [51553] (4 proteins) Pfam PF00933; Glycosyl hydrolase family 3 domain Some members have reversed beta strand compared to other members of fold |
![]() | Protein automated matches [191056] (3 species) not a true protein |
![]() | Species Hordeum vulgare [TaxId:112509] [270740] (32 PDB entries) |
![]() | Domain d6jgda1: 6jgd A:1-388 [390175] Other proteins in same PDB: d6jgda2, d6jgda3 automated match to d1x38a1 complexed with 1pe, act, gol, so4; mutant |
PDB Entry: 6jgd (more details), 2.13 Å
SCOPe Domain Sequences for d6jgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jgda1 c.1.8.7 (A:1-388) automated matches {Hordeum vulgare [TaxId: 112509]} dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdyegidrittpagsdy sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe npyadpamaeqlgkqehrdlareaarks
Timeline for d6jgda1: