SCOPe 2.07: Domain d7jh2b_: 7jh2 B:

Lineage for d7jh2b_ (7jh2 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d7jh2b_: 7jh2 B: [390158]
   automated match to d5ntwa_
   complexed with so4, vbg

Details for d7jh2b_

PDB Entry: 7jh2, 2.37 Å

PDB Description: crystal structure of rar-related orphan receptor c in complex with a potent, selective and orally bioavailable ror-gamma-t inverse agonist

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d7jh2b_:

Sequence; same for both SEQRES and ATOM records:

>d7jh2b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlh

Timeline for d7jh2b_:

• d7jh2b_ is new in SCOPe 2.07-stable
  
• d7jh2b_ appears in the current release, SCOPe 2.08