SCOPe 2.08: Domain d6jgba2: 6jgb A:389-602

Lineage for d6jgba2 (6jgb A:389-602)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families)
   automatically mapped to Pfam PF01915

5. Family c.23.11.0: automated matches [270742] (1 protein)
   not a true family

6. Protein automated matches [270743] (1 species)
   not a true protein

7. Species Hordeum vulgare [TaxId:112509] [270744] (32 PDB entries)

8. Domain d6jgba2: 6jgb A:389-602 [390147]
   Other proteins in same PDB: d6jgba1, d6jgba3
   automated match to d1x38a2
   complexed with 1pe, act, gol, nag, so4; mutant

Details for d6jgba2

PDB Entry: 6jgb, 1.47 Å

PDB Description: crystal structure of barley exohydrolasei w286f mutant in complex with methyl 6-thio-beta-gentiobioside

PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOPe Domain Sequences for d6jgba2:

Sequence; same for both SEQRES and ATOM records:

>d6jgba2 c.23.11.0 (A:389-602) automated matches {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

Timeline for d6jgba2:

• d6jgba2 first appeared in SCOPe 2.07