Lineage for d6jgba1 (6jgb A:1-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832028Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2832066Protein automated matches [191056] (3 species)
    not a true protein
  7. 2832067Species Hordeum vulgare [TaxId:112509] [270740] (32 PDB entries)
  8. 2832069Domain d6jgba1: 6jgb A:1-388 [390146]
    Other proteins in same PDB: d6jgba2, d6jgba3
    automated match to d1x38a1
    complexed with 1pe, act, gol, nag, so4; mutant

Details for d6jgba1

PDB Entry: 6jgb (more details), 1.47 Å

PDB Description: crystal structure of barley exohydrolasei w286f mutant in complex with methyl 6-thio-beta-gentiobioside
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOPe Domain Sequences for d6jgba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jgba1 c.1.8.7 (A:1-388) automated matches {Hordeum vulgare [TaxId: 112509]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdfegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

SCOPe Domain Coordinates for d6jgba1:

Click to download the PDB-style file with coordinates for d6jgba1.
(The format of our PDB-style files is described here.)

Timeline for d6jgba1: