Lineage for d7jfld_ (7jfl D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735240Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2735241Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2735242Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)
  6. 2735253Protein automated matches [190180] (2 species)
    not a true protein
  7. 2735254Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries)
  8. 2735256Domain d7jfld_: 7jfl D: [390141]
    automated match to d1zoqc_
    complexed with sep

Details for d7jfld_

PDB Entry: 7jfl (more details), 1.68 Å

PDB Description: crystal structure of human phosphorylated irf-3 bound to cbp
PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d7jfld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jfld_ a.153.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alqdllrtlkspsspqqqqqvlnilksnpqlmaafikq

SCOPe Domain Coordinates for d7jfld_:

Click to download the PDB-style file with coordinates for d7jfld_.
(The format of our PDB-style files is described here.)

Timeline for d7jfld_: