SCOPe 2.08: Domain d7jfld_: 7jfl D:

Lineage for d7jfld_ (7jfl D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
   3 helices, non-globular array; forms interlocked heterodimers with its targets

4. Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family)
   not a true superfamily

5. Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)

6. Protein automated matches [190180] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries)

8. Domain d7jfld_: 7jfl D: [390141]
   automated match to d1zoqc_
   complexed with sep

Details for d7jfld_

PDB Entry: 7jfl, 1.68 Å

PDB Description: crystal structure of human phosphorylated irf-3 bound to cbp

PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d7jfld_:

Sequence; same for both SEQRES and ATOM records:

>d7jfld_ a.153.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alqdllrtlkspsspqqqqqvlnilksnpqlmaafikq

Timeline for d7jfld_:

• d7jfld_ first appeared in SCOPe 2.07