Lineage for d4irzl2 (4irz L:106-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363195Domain d4irzl2: 4irz L:106-210 [390134]
    Other proteins in same PDB: d4irzl1
    automated match to d5x08l2
    complexed with ca, na, nag, nds, peg

Details for d4irzl2

PDB Entry: 4irz (more details), 2.84 Å

PDB Description: crystal structure of a4b7 headpiece complexed with fab natalizumab
PDB Compounds: (L:) Fab Natalizumab light chain

SCOPe Domain Sequences for d4irzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irzl2 b.1.1.2 (L:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4irzl2:

Click to download the PDB-style file with coordinates for d4irzl2.
(The format of our PDB-style files is described here.)

Timeline for d4irzl2: