![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
![]() | Domain d1h7xc5: 1h7x C:845-1020 [39013] Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa3, d1h7xa4, d1h7xb1, d1h7xb2, d1h7xb3, d1h7xb4, d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc4, d1h7xd1, d1h7xd2, d1h7xd3, d1h7xd4 complexed with fad, fmn, ndp, sf4, urf; mutant |
PDB Entry: 1h7x (more details), 2.01 Å
SCOPe Domain Sequences for d1h7xc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xc5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
Timeline for d1h7xc5:
![]() Domains from same chain: (mouse over for more information) d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc4 |