Lineage for d6hdja_ (6hdj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919696Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919697Protein beta-Phosphoglucomutase [75174] (3 species)
  7. 2919729Species Lactococcus lactis [TaxId:272623] [341074] (27 PDB entries)
  8. 2919733Domain d6hdja_: 6hdj A: [390120]
    automated match to d1o08a_
    complexed with alf, bg6, edo, mg

Details for d6hdja_

PDB Entry: 6hdj (more details), 1.16 Å

PDB Description: r49k variant of beta-phosphoglucomutase from lactococcus lactis complexed aluminium tetrafluoride and beta-g6p to 1.2 a.
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d6hdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdja_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 272623]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvskedslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqk

SCOPe Domain Coordinates for d6hdja_:

Click to download the PDB-style file with coordinates for d6hdja_.
(The format of our PDB-style files is described here.)

Timeline for d6hdja_: