SCOPe 2.08: Domain d6h93a_: 6h93 A:

Lineage for d6h93a_ (6h93 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein beta-Phosphoglucomutase [75174] (3 species)

7. Species Lactococcus lactis [TaxId:272623] [341074] (27 PDB entries)

8. Domain d6h93a_: 6h93 A: [390115]
   automated match to d1o08a_
   complexed with act, edo, mg, pdo, po4

Details for d6h93a_

PDB Entry: 6h93, 1.77 Å

PDB Description: beta-phosphoglucomutase from lactococcus lactis with inorganic phosphate bound in an open conformer to 1.8 a.

PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d6h93a_:

Sequence; same for both SEQRES and ATOM records:

>d6h93a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 272623]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqk

Timeline for d6h93a_:

• d6h93a_ first appeared in SCOPe 2.07