![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein beta-Phosphoglucomutase [75174] (3 species) |
![]() | Species Lactococcus lactis [TaxId:272623] [341074] (27 PDB entries) |
![]() | Domain d6h8ua_: 6h8u A: [390106] automated match to d1o08a_ complexed with edo, mg |
PDB Entry: 6h8u (more details), 1.9 Å
SCOPe Domain Sequences for d6h8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h8ua_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 272623]} mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd sgalpigvgrpedlgddivivpdtshytleflkevwlq
Timeline for d6h8ua_: