Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
Protein beta-Phosphoglucomutase [75174] (3 species) |
Species Lactococcus lactis [TaxId:272623] [341074] (27 PDB entries) |
Domain d6h8za_: 6h8z A: [390105] automated match to d1o08a_ complexed with edo, mg, mgf |
PDB Entry: 6h8z (more details), 1.6 Å
SCOPe Domain Sequences for d6h8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h8za_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 272623]} mfkavlfdldgvitdaaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd sgalpigvgrpedlgddivivpdtshytleflkevwlqk
Timeline for d6h8za_: