SCOPe 2.07: Domain d7cw4a2: 7cw4 A:269-393

Lineage for d7cw4a2 (7cw4 A:269-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [390062] (2 PDB entries)

8. Domain d7cw4a2: 7cw4 A:269-393 [390104]
   automated match to d5lp7a2
   complexed with gol

Details for d7cw4a2

PDB Entry: 7cw4, 1.56 Å

PDB Description: acetyl-coa acetyltransferase from bacillus cereus atcc 14579

PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d7cw4a2:

Sequence; same for both SEQRES and ATOM records:

>d7cw4a2 c.95.1.0 (A:269-393) automated matches {Bacillus cereus [TaxId: 226900]}
grkplatilahtaiaveskdfprtpgyainallektgktiedidlfeineafaavaiast
eiagidpeklnvnggavamghpigasgariivtlihalkqrgggigiasicsgggqgdav
mievh

Timeline for d7cw4a2:

• d7cw4a2 is new in SCOPe 2.07-stable
  
• d7cw4a2 appears in the current release, SCOPe 2.08