Lineage for d7d4aa1 (7d4a A:898-955)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784675Protein automated matches [190752] (1 species)
    not a true protein
  7. 2784676Species Human (Homo sapiens) [TaxId:9606] [187947] (8 PDB entries)
  8. 2784681Domain d7d4aa1: 7d4a A:898-955 [390091]
    Other proteins in same PDB: d7d4aa3
    automated match to d2qqra1
    complexed with so4

Details for d7d4aa1

PDB Entry: 7d4a (more details), 2.2 Å

PDB Description: the crystal structure of human jmjd2a tudor domain from biortus
PDB Compounds: (A:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d7d4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d4aa1 b.34.9.1 (A:898-955) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

SCOPe Domain Coordinates for d7d4aa1:

Click to download the PDB-style file with coordinates for d7d4aa1.
(The format of our PDB-style files is described here.)

Timeline for d7d4aa1: