SCOPe 2.08: Domain d7cu5b1: 7cu5 B:0-121

Lineage for d7cu5b1 (7cu5 B:0-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7cu5b1: 7cu5 B:0-121 [390081]
   Other proteins in same PDB: d7cu5e_, d7cu5q_
   automated match to d4f9lc2
   complexed with nag

Details for d7cu5b1

PDB Entry: 7cu5, 2.81 Å

PDB Description: n-glycosylation of pd-1 and glycosylation dependent binding of pd-1 specific monoclonal antibody camrelizumab

PDB Compounds: (B:) camrelizumab-scFv

SCOPe Domain Sequences for d7cu5b1:

Sequence; same for both SEQRES and ATOM records:

>d7cu5b1 b.1.1.0 (B:0-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mevqlvesggglvqpggslrlscaasgftfssymmswvrqapgkglewvatisggganty
ypdsvkgrftisrdnaknslylqmnslraedtavyycarqlyyfdywgqgttvtvssggg
gs

Timeline for d7cu5b1:

• d7cu5b1 first appeared in SCOPe 2.07