Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries) |
Domain d1h7wb5: 1h7w B:845-1018 [39008] Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa3, d1h7wa4, d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wc1, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOP Domain Sequences for d1h7wb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wb5 d.58.1.5 (B:845-1018) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglp
Timeline for d1h7wb5:
View in 3D Domains from same chain: (mouse over for more information) d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb4 |