Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [390062] (2 PDB entries) |
Domain d7cw4b1: 7cw4 B:2-268 [390072] automated match to d5lp7a1 complexed with gol |
PDB Entry: 7cw4 (more details), 1.56 Å
SCOPe Domain Sequences for d7cw4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cw4b1 c.95.1.0 (B:2-268) automated matches {Bacillus cereus [TaxId: 226900]} sktvilsaartpvgkfggslkdvkatelggiaikaaleranvaasdveevifgtviqggq gqipsrqaaraagipwevqtetvnkvcasglravtladqiirtgdqslivaggmesmsns pyilrgarwgyrmgnnevidlnvadgltcafsgthmgvyggevakedgisreaqdewayr shqravsahkegrfeeeivpvtipqrkgdpivvakdeapredttieklaklkpvfdktat vtagnapglndggaalvlmsedrakqe
Timeline for d7cw4b1: