SCOPe 2.07: Domain d7cy3a_: 7cy3 A:

Lineage for d7cy3a_ (7cy3 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Paraphoma sp. [TaxId:1804209] [390066] (2 PDB entries)

8. Domain d7cy3a_: 7cy3 A: [390067]
   automated match to d4oyyc_
   complexed with cad, na

Details for d7cy3a_

PDB Entry: 7cy3, 1.27 Å

PDB Description: crystal structure of a biodegradable plastic-degrading cutinase from paraphoma sp. b47-9.

PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d7cy3a_:

Sequence; same for both SEQRES and ATOM records:

>d7cy3a_ c.69.1.0 (A:) automated matches {Paraphoma sp. [TaxId: 1804209]}
gsskneletgsasncpkailifargstetgnlgtlgaplgdalesrygasnvwvqgvggp
ydaalgdnalprgssaaairegvrllnlanskcpnskvvaggysqgaalaaaaisdastt
vrnqivgtvlfgytknqqnrggipgypqdrlrvycavgdlvcegtlivlaphlsygdear
neapafliskign

Timeline for d7cy3a_:

• d7cy3a_ is new in SCOPe 2.07-stable
  
• d7cy3a_ appears in the current release, SCOPe 2.08