Lineage for d2pdaa5 (2pda A:669-785)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (4 proteins) 
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) Species Desulfovibrio africanus [TaxId:873] [54890] (2 PDB entries) 
Domain d2pdaa5: 2pda A:669-785 [39005]
Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa3, d2pdaa4, d2pdab1, d2pdab2, d2pdab3, d2pdab4
Details for d2pdaa5
PDB Entry: 2pda (more details), 3 Å
PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.
SCOP Domain Sequences for d2pdaa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdaa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
SCOP Domain Coordinates for d2pdaa5:
Click to download the PDB-style file with coordinates for d2pdaa5.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pdaa5:
- d2pdaa5 appears in SCOP 1.57
- d2pdaa5 appears in the current release, SCOPe 2.08
View in 3D
