Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [54890] (3 PDB entries) |
Domain d1b0pa5: 1b0p A:669-785 [39003] Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa4, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb4 |
PDB Entry: 1b0p (more details), 2.31 Å
SCOP Domain Sequences for d1b0pa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0pa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d1b0pa5: