Lineage for d1b0pa5 (1b0p A:669-785)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328743Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 328830Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 328872Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 328873Species Desulfovibrio africanus [TaxId:873] [54890] (3 PDB entries)
  8. 328876Domain d1b0pa5: 1b0p A:669-785 [39003]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa4, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb4

Details for d1b0pa5

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d1b0pa5:

Click to download the PDB-style file with coordinates for d1b0pa5.
(The format of our PDB-style files is described here.)

Timeline for d1b0pa5: