![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:10665] [390028] (1 PDB entry) |
![]() | Domain d7cn7a_: 7cn7 A: [390029] automated match to d2qarc_ complexed with 1pg, cl, edo, na |
PDB Entry: 7cn7 (more details), 1.15 Å
SCOPe Domain Sequences for d7cn7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cn7a_ d.2.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10665]} eiptddnpnmsmaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskq vgreitgnpgsitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenmafqm gvggvakfntmltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygve
Timeline for d7cn7a_: