SCOPe 2.05: Domain d1hfel2: 1hfe L:2-86

Lineage for d1hfel2 (1hfe L:2-86)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Fe-only hydrogenase larger subunit, N-domain [54887] (1 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [54888] (1 PDB entry)

8. Domain d1hfel2: 1hfe L:2-86 [39001]
   Other proteins in same PDB: d1hfel1, d1hfem1, d1hfes_, d1hfet_
   complexed with cmo, cyn, cys, fe2, pdt, sf4, zn

Details for d1hfel2

PDB Entry: 1hfe, 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans

PDB Compounds: (L:) protein (fe-only hydrogenase (e.c.1.18.99.1) (larger subunit))

SCOPe Domain Sequences for d1hfel2:

Sequence; same for both SEQRES and ATOM records:

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}
srtvmerieyemhtpdpkadpdklhfvqideakcigcdtcsqycptaaifgemgephsip
hieacincgqclthcpenaiyeaqs

Timeline for d1hfel2:

• d1hfel2 first appeared (with stable ids) in SCOP 1.55
  
• d1hfel2 appears in SCOPe 2.04
  
• d1hfel2 appears in SCOPe 2.06
  
• d1hfel2 appears in the current release, SCOPe 2.08