SCOPe 2.06: Domain d1c4aa3: 1c4a A:127-209

Lineage for d1c4aa3 (1c4a A:127-209)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Fe-only hydrogenase, second domain [54885] (1 species)

7. Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries)

8. Domain d1c4aa3: 1c4a A:127-209 [39000]
   Other proteins in same PDB: d1c4aa1, d1c4aa2
   complexed with fes, hc1, sf4

Details for d1c4aa3

PDB Entry: 1c4a, 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum

PDB Compounds: (A:) protein (fe-only hydrogenase)

SCOPe Domain Sequences for d1c4aa3:

Sequence; same for both SEQRES and ATOM records:

>d1c4aa3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

Timeline for d1c4aa3:

• d1c4aa3 first appeared (with stable ids) in SCOP 1.55
  
• d1c4aa3 appears in SCOPe 2.05
  
• d1c4aa3 appears in SCOPe 2.07
  
• d1c4aa3 appears in the current release, SCOPe 2.08