SCOPe 2.08: Domain d7c81l1: 7c81 L:1-106

Lineage for d7c81l1 (7c81 L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7c81l1: 7c81 L:1-106 [389999]
   Other proteins in same PDB: d7c81a_, d7c81c_, d7c81h2, d7c81l2
   automated match to d1gm3l1
   complexed with sph

Details for d7c81l1

PDB Entry: 7c81, 3.1 Å

PDB Description: e30 f-particle in complex with 6c5

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d7c81l1:

Sequence; same for both SEQRES and ATOM records:

>d7c81l1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimsaspgekvtmtcsassslrymhwyqqksgtspkrwiydtynlasgvpvr
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelk

Timeline for d7c81l1:

• d7c81l1 first appeared in SCOPe 2.07