Lineage for d7cmna1 (7cmn A:8-158)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2573111Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2573346Protein automated matches [254656] (4 species)
    not a true protein
  7. 2573431Species Bacillus sp. [TaxId:36824] [312567] (14 PDB entries)
  8. 2573432Domain d7cmna1: 7cmn A:8-158 [389990]
    automated match to d1j2ga1
    complexed with aza, edo, oxy, so4

Details for d7cmna1

PDB Entry: 7cmn (more details), 1.42 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 88% rh.
PDB Compounds: (A:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d7cmna1:

Sequence, based on SEQRES records: (download)

>d7cmna1 d.96.1.4 (A:8-158) automated matches {Bacillus sp. [TaxId: 36824]}
vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
vkngnraaselvfkksrneyataylnmvrne

Sequence, based on observed residues (ATOM records): (download)

>d7cmna1 d.96.1.4 (A:8-158) automated matches {Bacillus sp. [TaxId: 36824]}
vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
vnraaselvfkksrneyataylnmvrne

SCOPe Domain Coordinates for d7cmna1:

Click to download the PDB-style file with coordinates for d7cmna1.
(The format of our PDB-style files is described here.)

Timeline for d7cmna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7cmna2