Lineage for d7cmnb2 (7cmn B:159-310)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein automated matches [254656] (4 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries)
  8. Domain d7cmnb2: 7cmn B:159-310 [389989]
    automated match to d1j2ga2
    complexed with aza, edo, oxy, so4

Details for d7cmnb2

PDB Entry: 7cmn (more details), 1.42 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 88% rh.
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d7cmnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cmnb2 d.96.1.4 (B:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtq

SCOPe Domain Coordinates for d7cmnb2 are not available.

Timeline for d7cmnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7cmnb1
View in 3D
Domains from other chains:
(mouse over for more information)
d7cmna1, d7cmna2